PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G28610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 364aa    MW: 40282.7 Da    PI: 5.0325
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G28610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.6e-18165219256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++keq   Le+ F+++++++ +++ +LA++l+L  rqV vWFqNrRa+ k
  OB02G28610.1 165 RKKLRLSKEQSSFLEDSFREHSTLTLKQKSDLANRLNLRPRQVEVWFQNRRARTK 219
                   788899***********************************************98 PP

2HD-ZIP_I/II115.63e-37165252188
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                   +kk+rlskeq+++LE+sF+e+++L+ ++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr +++l++en+rL++ev+eLr
  OB02G28610.1 165 RKKLRLSKEQSSFLEDSFREHSTLTLKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQMEVDCEQLKRYCERLTQENRRLQREVAELR 252
                   69*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-17147219IPR009057Homeodomain-like
SuperFamilySSF466892.34E-17157222IPR009057Homeodomain-like
PROSITE profilePS5007116.941161221IPR001356Homeobox domain
SMARTSM003891.5E-15163225IPR001356Homeobox domain
CDDcd000866.09E-15165222No hitNo description
PfamPF000462.7E-15165219IPR001356Homeobox domain
PROSITE patternPS000270196219IPR017970Homeobox, conserved site
CDDcd146860.00588214252No hitNo description
PfamPF021837.2E-9221252IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.2E-17221264IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MTPLCLLDME LELSLGDSPA PVKATTVVPT PVPPPTCMSE GEGLELVLGV RASSRDEQDS  60
QATCTQSSEE AMEGSVEDEA RTHGEAPLES LSLPLFVFFA EPLTGSENSE LCTRGLDVNT  120
RPADGGAAEV RPSSSPPSML EASTRQQAAD QLEAADEESG GGGARKKLRL SKEQSSFLED  180
SFREHSTLTL KQKSDLANRL NLRPRQVEVW FQNRRARTKL KQMEVDCEQL KRYCERLTQE  240
NRRLQREVAE LRVLRTTPST YPPLYGGPXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXVWSPAAG SPAASAALFA RRPHFGPFAA VIPPVLRRQP  360
SATS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213221RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648759.21e-158PREDICTED: homeobox-leucine zipper protein HOX7-like
SwissprotA2X6741e-129HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
SwissprotQ0E0A61e-129HOX7_ORYSJ; Homeobox-leucine zipper protein HOX7
TrEMBLJ3LDZ40.0J3LDZ4_ORYBR; Uncharacterized protein
STRINGOB02G28610.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-44homeobox from Arabidopsis thaliana